Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3869821..3870515 Replicon chromosome
Accession NZ_CP117006
Organism Escherichia coli strain MLI108K3

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NL411_RS20450 Protein ID WP_001263491.1
Coordinates 3869821..3870219 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL411_RS20455 Protein ID WP_000554755.1
Coordinates 3870222..3870515 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3865650) 3865650..3865730 - 81 NuclAT_11 - -
- (3865650) 3865650..3865730 - 81 NuclAT_11 - -
- (3865650) 3865650..3865730 - 81 NuclAT_11 - -
- (3865650) 3865650..3865730 - 81 NuclAT_11 - -
NL411_RS20420 (3864990) 3864990..3866234 - 1245 WP_000189541.1 esterase FrsA -
NL411_RS20425 (3866326) 3866326..3866784 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL411_RS20430 (3867045) 3867045..3868502 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL411_RS20435 (3868559) 3868559..3868911 - 353 Protein_3681 peptide chain release factor H -
NL411_RS20440 (3868907) 3868907..3869113 - 207 Protein_3682 RtcB family protein -
NL411_RS20445 (3869359) 3869359..3869811 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NL411_RS20450 (3869821) 3869821..3870219 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL411_RS20455 (3870222) 3870222..3870515 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL411_RS20460 (3870567) 3870567..3871622 - 1056 WP_001550655.1 DNA polymerase IV -
NL411_RS20465 (3871693) 3871693..3872478 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NL411_RS20470 (3872450) 3872450..3874162 + 1713 Protein_3688 flagellar biosynthesis protein FlhA -
NL411_RS20475 (3874267) 3874267..3874545 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NL411_RS20480 (3874538) 3874538..3874894 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T269753 WP_001263491.1 NZ_CP117006:c3870219-3869821 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269753 WP_000554755.1 NZ_CP117006:c3870515-3870222 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References