Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42693..42947 | Replicon | plasmid p89_MLI108-3 |
| Accession | NZ_CP117004 | ||
| Organism | Escherichia coli strain MLI108K3 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NL411_RS01365 | Protein ID | WP_001312851.1 |
| Coordinates | 42693..42842 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 42886..42947 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL411_RS01320 (38890) | 38890..39150 | + | 261 | Protein_43 | transposase | - |
| NL411_RS01325 (39160) | 39160..39333 | - | 174 | Protein_44 | hypothetical protein | - |
| NL411_RS01330 (39345) | 39345..39482 | - | 138 | WP_152931508.1 | hypothetical protein | - |
| NL411_RS01335 (39535) | 39535..39813 | - | 279 | WP_250145987.1 | type II toxin-antitoxin system toxin YacB | - |
| NL411_RS01340 (39813) | 39813..40082 | - | 270 | WP_000079938.1 | type II toxin-antitoxin system antitoxin YacA | - |
| NL411_RS01345 (40155) | 40155..40295 | - | 141 | WP_160784086.1 | hypothetical protein | - |
| NL411_RS01350 (40996) | 40996..41853 | - | 858 | WP_025269864.1 | incFII family plasmid replication initiator RepA | - |
| NL411_RS01355 (41846) | 41846..41920 | - | 75 | WP_061357229.1 | RepA leader peptide Tap | - |
| NL411_RS01360 (42152) | 42152..42409 | - | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| NL411_RS01365 (42693) | 42693..42842 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (42886) | 42886..42947 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (42886) | 42886..42947 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (42886) | 42886..42947 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (42886) | 42886..42947 | + | 62 | NuclAT_0 | - | Antitoxin |
| NL411_RS01370 (43289) | 43289..43501 | - | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| NL411_RS01375 (43636) | 43636..44196 | - | 561 | WP_097734074.1 | fertility inhibition protein FinO | - |
| NL411_RS01380 (44251) | 44251..44997 | - | 747 | WP_001541899.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..89004 | 89004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269731 WP_001312851.1 NZ_CP117004:c42842-42693 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269731 NZ_CP117004:42886-42947 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
