Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 595342..595980 | Replicon | chromosome |
Accession | NZ_CP117001 | ||
Organism | Escherichia coli strain MLI108K2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | NL410_RS04795 | Protein ID | WP_001447010.1 |
Coordinates | 595342..595518 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NL410_RS04800 | Protein ID | WP_001270286.1 |
Coordinates | 595564..595980 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL410_RS04775 (590961) | 590961..592136 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
NL410_RS04780 (592228) | 592228..592764 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NL410_RS04785 (592837) | 592837..594798 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NL410_RS04790 (594890) | 594890..595120 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NL410_RS04795 (595342) | 595342..595518 | + | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NL410_RS04800 (595564) | 595564..595980 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NL410_RS04805 (596059) | 596059..597465 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NL410_RS04810 (597710) | 597710..598855 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NL410_RS04815 (598873) | 598873..599886 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NL410_RS04820 (599887) | 599887..600828 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 589773..590921 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T269708 WP_001447010.1 NZ_CP117001:595342-595518 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269708 WP_001270286.1 NZ_CP117001:595564-595980 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|