Detailed information of TA system TA269699

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 89135..89368
• Replicon: plasmid p172_MLI108-2
• Accession: NZ_CP116995
• Organism: Escherichia coli strain MLI108K2

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NL410_RS00535
• Protein ID: WP_001372321.1
• Coordinates: 89243..89368 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	89135..89166 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NL410_RS00480 (84366)	84366..84572	+	207	WP_001774176.1	hypothetical protein	-
NL410_RS00485 (84491)	84491..84742	+	252	WP_071579736.1	hypothetical protein	-
NL410_RS00490 (84982)	84982..85188	+	207	WP_000275856.1	hypothetical protein	-
NL410_RS00495 (85214)	85214..85753	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
NL410_RS00500 (85821)	85821..86054	+	234	WP_000005990.1	DUF905 family protein	-
NL410_RS00505 (86082)	86082..86279	+	198	Protein_100	hypothetical protein	-
NL410_RS00510 (86334)	86334..86768	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
NL410_RS00515 (86765)	86765..87527	+	763	Protein_102	plasmid SOS inhibition protein A	-
NL410_RS00520 (87496)	87496..87684	-	189	WP_001299721.1	hypothetical protein	-
- (87496)	87496..87693	+	198	NuclAT_0	-	-
- (87496)	87496..87693	+	198	NuclAT_0	-	-
- (87496)	87496..87693	+	198	NuclAT_0	-	-
- (87496)	87496..87693	+	198	NuclAT_0	-	-
NL410_RS00525 (87741)	87741..89110	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
- (89135)	89135..89166	+	32	NuclAT_1	-	Antitoxin
- (89135)	89135..89166	+	32	NuclAT_1	-	Antitoxin
- (89135)	89135..89166	+	32	NuclAT_1	-	Antitoxin
- (89135)	89135..89166	+	32	NuclAT_1	-	Antitoxin
NL410_RS00530 (89152)	89152..89301	+	150	Protein_105	plasmid maintenance protein Mok	-
NL410_RS00535 (89243)	89243..89368	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NL410_RS00540 (89588)	89588..89818	+	231	WP_071886920.1	hypothetical protein	-
NL410_RS00545 (89816)	89816..89988	-	173	Protein_108	hypothetical protein	-
NL410_RS00550 (90058)	90058..90264	+	207	WP_000547968.1	hypothetical protein	-
NL410_RS00555 (90289)	90289..90576	+	288	WP_000107535.1	hypothetical protein	-
NL410_RS00560 (90694)	90694..91515	+	822	WP_001234426.1	DUF932 domain-containing protein	-
NL410_RS00565 (91812)	91812..92414	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
NL410_RS00570 (92735)	92735..93118	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NL410_RS00575 (93305)	93305..93994	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / mph(A) / sitABCD / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1	iucA / iucB / iucC / iucD / iutA	1..172011	172011

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T269699 WP_001372321.1 NZ_CP116995:89243-89368 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 32 bp

>AT269699 NZ_CP116995:89135-89166 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin