Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 595363..596001 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | NL409_RS04790 | Protein ID | WP_001447010.1 |
Coordinates | 595363..595539 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NL409_RS04795 | Protein ID | WP_001270286.1 |
Coordinates | 595585..596001 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS04770 (590982) | 590982..592157 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
NL409_RS04775 (592249) | 592249..592785 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NL409_RS04780 (592858) | 592858..594819 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NL409_RS04785 (594911) | 594911..595141 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NL409_RS04790 (595363) | 595363..595539 | + | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NL409_RS04795 (595585) | 595585..596001 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NL409_RS04800 (596080) | 596080..597486 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NL409_RS04805 (597731) | 597731..598876 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NL409_RS04810 (598894) | 598894..599907 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NL409_RS04815 (599908) | 599908..600849 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 589794..590942 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T269677 WP_001447010.1 NZ_CP116994:595363-595539 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269677 WP_001270286.1 NZ_CP116994:595585-596001 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|