Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 129181..129435 | Replicon | plasmid p172_MLI108-1 |
| Accession | NZ_CP116988 | ||
| Organism | Escherichia coli strain MLI108K1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NL409_RS00780 | Protein ID | WP_001312851.1 |
| Coordinates | 129286..129435 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 129181..129242 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL409_RS00745 (124833) | 124833..125045 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| NL409_RS00750 (125346) | 125346..125435 | - | 90 | Protein_149 | IS1 family transposase | - |
| NL409_RS00755 (125490) | 125490..126167 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| NL409_RS00760 (126167) | 126167..126514 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NL409_RS00765 (126534) | 126534..128105 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| NL409_RS00770 (128143) | 128143..128759 | - | 617 | Protein_153 | IS1-like element IS1A family transposase | - |
| NL409_RS00775 (128860) | 128860..129042 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (129181) | 129181..129242 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (129181) | 129181..129242 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (129181) | 129181..129242 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (129181) | 129181..129242 | - | 62 | NuclAT_2 | - | Antitoxin |
| NL409_RS00780 (129286) | 129286..129435 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NL409_RS00785 (129719) | 129719..129976 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NL409_RS00790 (130212) | 130212..130286 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| NL409_RS00795 (130279) | 130279..130725 | + | 447 | Protein_158 | plasmid replication initiator RepA | - |
| NL409_RS00800 (130725) | 130725..131339 | - | 615 | Protein_159 | VENN motif pre-toxin domain-containing protein | - |
| NL409_RS00805 (132046) | 132046..133266 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| NL409_RS00810 (133277) | 133277..134188 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / mph(A) / sitABCD / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 | iucA / iucB / iucC / iucD / iutA | 1..172011 | 172011 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269671 WP_001312851.1 NZ_CP116988:129286-129435 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269671 NZ_CP116988:c129242-129181 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
