Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4588336..4588938 | Replicon | chromosome |
Accession | NZ_CP116987 | ||
Organism | Escherichia coli strain MLI107 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NL408_RS22220 | Protein ID | WP_000897305.1 |
Coordinates | 4588627..4588938 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL408_RS22215 | Protein ID | WP_000356397.1 |
Coordinates | 4588336..4588626 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL408_RS22190 (4584280) | 4584280..4585182 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NL408_RS22195 (4585179) | 4585179..4585814 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL408_RS22200 (4585811) | 4585811..4586740 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NL408_RS22205 (4587070) | 4587070..4587312 | - | 243 | WP_001087409.1 | protein YiiF | - |
NL408_RS22210 (4587532) | 4587532..4587750 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
NL408_RS22215 (4588336) | 4588336..4588626 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NL408_RS22220 (4588627) | 4588627..4588938 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NL408_RS22225 (4589167) | 4589167..4590075 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NL408_RS22230 (4590139) | 4590139..4591080 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NL408_RS22235 (4591125) | 4591125..4591562 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NL408_RS22240 (4591559) | 4591559..4592431 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NL408_RS22245 (4592425) | 4592425..4593024 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
NL408_RS22250 (4593123) | 4593123..4593908 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269665 WP_000897305.1 NZ_CP116987:c4588938-4588627 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|