Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 608902..609701 | Replicon | chromosome |
Accession | NZ_CP116987 | ||
Organism | Escherichia coli strain MLI107 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | NL408_RS02975 | Protein ID | WP_000347267.1 |
Coordinates | 608902..609366 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NL408_RS02980 | Protein ID | WP_001307405.1 |
Coordinates | 609366..609701 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL408_RS02945 (603903) | 603903..604337 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NL408_RS02950 (604355) | 604355..605233 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NL408_RS02955 (605223) | 605223..606002 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NL408_RS02960 (606013) | 606013..606486 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NL408_RS02965 (606509) | 606509..607789 | - | 1281 | WP_000681936.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NL408_RS02970 (608038) | 608038..608847 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NL408_RS02975 (608902) | 608902..609366 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NL408_RS02980 (609366) | 609366..609701 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NL408_RS02985 (609850) | 609850..611421 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
NL408_RS02990 (611796) | 611796..613130 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NL408_RS02995 (613146) | 613146..613916 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 608902..620470 | 11568 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T269648 WP_000347267.1 NZ_CP116987:c609366-608902 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |