Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 155097..155351 | Replicon | plasmid pE6474.1 |
Accession | NZ_CP116982 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | PO910_RS23920 | Protein ID | WP_001312851.1 |
Coordinates | 155202..155351 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 155097..155158 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS23905 (153050) | 153050..153793 | + | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
PO910_RS23910 (153848) | 153848..154408 | + | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
PO910_RS23915 (154543) | 154543..154755 | + | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
- (155097) | 155097..155158 | - | 62 | NuclAT_1 | - | Antitoxin |
- (155097) | 155097..155158 | - | 62 | NuclAT_1 | - | Antitoxin |
- (155097) | 155097..155158 | - | 62 | NuclAT_1 | - | Antitoxin |
- (155097) | 155097..155158 | - | 62 | NuclAT_1 | - | Antitoxin |
PO910_RS23920 (155202) | 155202..155351 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
PO910_RS23925 (155619) | 155619..155876 | + | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
PO910_RS23930 (155979) | 155979..156162 | + | 184 | Protein_175 | plasmid copy control protein CopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / sul3 | - | 1..156174 | 156174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269642 WP_001312851.1 NZ_CP116982:155202-155351 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269642 NZ_CP116982:c155158-155097 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|