Detailed information of TA system TA269640

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 118406..118675
• Replicon: plasmid pE6474.1
• Accession: NZ_CP116982
• Organism: Escherichia coli strain E6474

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PO910_RS23720
• Protein ID: WP_001372321.1
• Coordinates: 118550..118675 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	118406..118471 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PO910_RS23685	114180..114719	+	540	WP_032332913.1	single-stranded DNA-binding protein	-
PO910_RS23690	114776..115009	+	234	WP_000005987.1	DUF905 family protein	-
PO910_RS23695	115074..117032	+	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
PO910_RS23700	117087..117521	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PO910_RS23705	117518..118280	+	763	Protein_130	plasmid SOS inhibition protein A	-
PO910_RS23710	118249..118437	-	189	WP_001299721.1	hypothetical protein	-
-	118249..118473	+	225	NuclAT_0	-	-
-	118249..118473	+	225	NuclAT_0	-	-
-	118249..118473	+	225	NuclAT_0	-	-
-	118249..118473	+	225	NuclAT_0	-	-
-	118406..118471	-	66	-	-	Antitoxin
PO910_RS23715	118459..118608	+	150	Protein_132	plasmid maintenance protein Mok	-
PO910_RS23720	118550..118675	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PO910_RS23725	118895..119125	+	231	WP_001426396.1	hypothetical protein	-
PO910_RS23730	119123..119296	-	174	Protein_135	hypothetical protein	-
PO910_RS23735	119366..119626	+	261	WP_042046747.1	hypothetical protein	-
PO910_RS23740	119720..120724	-	1005	WP_024257664.1	IS110 family transposase	-
PO910_RS23745	120975..121262	+	288	WP_000107535.1	hypothetical protein	-
PO910_RS23750	121383..122204	+	822	WP_001234469.1	DUF932 domain-containing protein	-
PO910_RS23755	122501..123103	-	603	WP_097738799.1	transglycosylase SLT domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / sul3	-	1..156174	156174

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T269640 WP_001372321.1 NZ_CP116982:118550-118675 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT269640 NZ_CP116982:c118471-118406 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin