Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 118406..118675 | Replicon | plasmid pE6474.1 |
Accession | NZ_CP116982 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | PO910_RS23720 | Protein ID | WP_001372321.1 |
Coordinates | 118550..118675 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 118406..118471 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS23685 | 114180..114719 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
PO910_RS23690 | 114776..115009 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
PO910_RS23695 | 115074..117032 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
PO910_RS23700 | 117087..117521 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
PO910_RS23705 | 117518..118280 | + | 763 | Protein_130 | plasmid SOS inhibition protein A | - |
PO910_RS23710 | 118249..118437 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 118249..118473 | + | 225 | NuclAT_0 | - | - |
- | 118249..118473 | + | 225 | NuclAT_0 | - | - |
- | 118249..118473 | + | 225 | NuclAT_0 | - | - |
- | 118249..118473 | + | 225 | NuclAT_0 | - | - |
- | 118406..118471 | - | 66 | - | - | Antitoxin |
PO910_RS23715 | 118459..118608 | + | 150 | Protein_132 | plasmid maintenance protein Mok | - |
PO910_RS23720 | 118550..118675 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
PO910_RS23725 | 118895..119125 | + | 231 | WP_001426396.1 | hypothetical protein | - |
PO910_RS23730 | 119123..119296 | - | 174 | Protein_135 | hypothetical protein | - |
PO910_RS23735 | 119366..119626 | + | 261 | WP_042046747.1 | hypothetical protein | - |
PO910_RS23740 | 119720..120724 | - | 1005 | WP_024257664.1 | IS110 family transposase | - |
PO910_RS23745 | 120975..121262 | + | 288 | WP_000107535.1 | hypothetical protein | - |
PO910_RS23750 | 121383..122204 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
PO910_RS23755 | 122501..123103 | - | 603 | WP_097738799.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / sul3 | - | 1..156174 | 156174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T269640 WP_001372321.1 NZ_CP116982:118550-118675 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT269640 NZ_CP116982:c118471-118406 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|