Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4725726..4726328 | Replicon | chromosome |
| Accession | NZ_CP116981 | ||
| Organism | Escherichia coli strain E6474 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PO910_RS22880 | Protein ID | WP_000897305.1 |
| Coordinates | 4725726..4726037 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PO910_RS22885 | Protein ID | WP_000356397.1 |
| Coordinates | 4726038..4726328 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO910_RS22855 (4721640) | 4721640..4722239 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| PO910_RS22860 (4722233) | 4722233..4723105 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PO910_RS22865 (4723102) | 4723102..4723539 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| PO910_RS22870 (4723584) | 4723584..4724525 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PO910_RS22875 (4724589) | 4724589..4725497 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| PO910_RS22880 (4725726) | 4725726..4726037 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PO910_RS22885 (4726038) | 4726038..4726328 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PO910_RS22890 (4726914) | 4726914..4727132 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| PO910_RS22895 (4727351) | 4727351..4727593 | + | 243 | WP_001087409.1 | protein YiiF | - |
| PO910_RS22900 (4727923) | 4727923..4728852 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| PO910_RS22905 (4728849) | 4728849..4729484 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PO910_RS22910 (4729481) | 4729481..4730383 | - | 903 | WP_272753579.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269637 WP_000897305.1 NZ_CP116981:4725726-4726037 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|