Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3911192..3911991 | Replicon | chromosome |
Accession | NZ_CP116981 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | PO910_RS18925 | Protein ID | WP_000347266.1 |
Coordinates | 3911527..3911991 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PO910_RS18920 | Protein ID | WP_001307405.1 |
Coordinates | 3911192..3911527 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS18905 (3906978) | 3906978..3907748 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PO910_RS18910 (3907764) | 3907764..3909098 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PO910_RS18915 (3909473) | 3909473..3911043 | + | 1571 | Protein_3690 | galactarate dehydratase | - |
PO910_RS18920 (3911192) | 3911192..3911527 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PO910_RS18925 (3911527) | 3911527..3911991 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PO910_RS18930 (3912046) | 3912046..3912855 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PO910_RS18935 (3913104) | 3913104..3914384 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PO910_RS18940 (3914407) | 3914407..3914880 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PO910_RS18945 (3914891) | 3914891..3915670 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PO910_RS18950 (3915660) | 3915660..3916538 | + | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PO910_RS18955 (3916556) | 3916556..3916990 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3900537..3911991 | 11454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T269635 WP_000347266.1 NZ_CP116981:3911527-3911991 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |