Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2022359..2022730 | Replicon | chromosome |
| Accession | NZ_CP116981 | ||
| Organism | Escherichia coli strain E6474 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | PO910_RS09830 | Protein ID | WP_001317028.1 |
| Coordinates | 2022536..2022730 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2022359..2022537 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO910_RS09800 (2018111) | 2018111..2018284 | + | 174 | WP_001296046.1 | protein YnaL | - |
| PO910_RS09805 (2018314) | 2018314..2019687 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
| PO910_RS09810 (2019816) | 2019816..2020751 | - | 936 | WP_272753981.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| PO910_RS09815 (2020803) | 2020803..2022038 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| PO910_RS09820 (2022040) | 2022040..2022255 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2022359) | 2022359..2022537 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2022359) | 2022359..2022537 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2022359) | 2022359..2022537 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2022359) | 2022359..2022537 | + | 179 | NuclAT_0 | - | Antitoxin |
| PO910_RS09825 (2022334) | 2022334..2022543 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| PO910_RS09830 (2022536) | 2022536..2022730 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| PO910_RS09835 (2022787) | 2022787..2023596 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| PO910_RS09840 (2023589) | 2023589..2026189 | - | 2601 | WP_001532611.1 | exodeoxyribonuclease VIII | - |
| PO910_RS09845 (2026291) | 2026291..2026566 | - | 276 | WP_000632297.1 | protein RacC | - |
| PO910_RS09850 (2026641) | 2026641..2026811 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| PO910_RS09855 (2026811) | 2026811..2027032 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2020803..2049434 | 28631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T269622 WP_001317028.1 NZ_CP116981:c2022730-2022536 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT269622 NZ_CP116981:2022359-2022537 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|