Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51124..51388 | Replicon | plasmid pCUVM53-1 |
| Accession | NZ_CP116977 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | PQP10_RS23105 | Protein ID | WP_001331364.1 |
| Coordinates | 51236..51388 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 51124..51181 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS23090 (46379) | 46379..48670 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| PQP10_RS23095 (48663) | 48663..49733 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| PQP10_RS23100 (49752) | 49752..50960 | - | 1209 | WP_052980401.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (51124) | 51124..51181 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (51124) | 51124..51181 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (51124) | 51124..51181 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (51124) | 51124..51181 | - | 58 | NuclAT_0 | - | Antitoxin |
| PQP10_RS23105 (51236) | 51236..51388 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| PQP10_RS23110 (51460) | 51460..51711 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| PQP10_RS23115 (52210) | 52210..52305 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| PQP10_RS23120 (52370) | 52370..52507 | - | 138 | WP_047088497.1 | hypothetical protein | - |
| PQP10_RS23125 (52606) | 52606..54177 | - | 1572 | WP_029392005.1 | IS66-like element ISCro1 family transposase | - |
| PQP10_RS23130 (54197) | 54197..54544 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PQP10_RS23135 (54544) | 54544..55221 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-3.5 | - | 1..100405 | 100405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T269606 WP_001331364.1 NZ_CP116977:51236-51388 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT269606 NZ_CP116977:c51181-51124 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|