Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3979875..3980569 | Replicon | chromosome |
| Accession | NZ_CP116976 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | PQP10_RS19270 | Protein ID | WP_001263493.1 |
| Coordinates | 3980171..3980569 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | PQP10_RS19265 | Protein ID | WP_000554757.1 |
| Coordinates | 3979875..3980168 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS19245 (3975515) | 3975515..3976012 | + | 498 | WP_000006261.1 | REP-associated tyrosine transposase RayT | - |
| PQP10_RS19250 (3976228) | 3976228..3977940 | - | 1713 | Protein_3749 | flagellar biosynthesis protein FlhA | - |
| PQP10_RS19255 (3977912) | 3977912..3978697 | + | 786 | WP_072132640.1 | putative lateral flagellar export/assembly protein LafU | - |
| PQP10_RS19260 (3978768) | 3978768..3979823 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| PQP10_RS19265 (3979875) | 3979875..3980168 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PQP10_RS19270 (3980171) | 3980171..3980569 | + | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PQP10_RS19275 (3980579) | 3980579..3981031 | + | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| PQP10_RS19280 (3981277) | 3981277..3981480 | + | 204 | Protein_3755 | RtcB family protein | - |
| PQP10_RS19285 (3981479) | 3981479..3982000 | + | 522 | Protein_3756 | peptide chain release factor H | - |
| PQP10_RS19290 (3982057) | 3982057..3983514 | - | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| PQP10_RS19295 (3983775) | 3983775..3984233 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (3984829) | 3984829..3984909 | + | 81 | NuclAT_10 | - | - |
| - (3984829) | 3984829..3984909 | + | 81 | NuclAT_10 | - | - |
| - (3984829) | 3984829..3984909 | + | 81 | NuclAT_10 | - | - |
| - (3984829) | 3984829..3984909 | + | 81 | NuclAT_10 | - | - |
| PQP10_RS19300 (3984325) | 3984325..3985569 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T269602 WP_001263493.1 NZ_CP116976:3980171-3980569 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|