Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3741058..3741751 | Replicon | chromosome |
Accession | NZ_CP116976 | ||
Organism | Escherichia coli strain CUVM53 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PQP10_RS18125 | Protein ID | WP_000415584.1 |
Coordinates | 3741058..3741354 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PQP10_RS18130 | Protein ID | WP_000650107.1 |
Coordinates | 3741356..3741751 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP10_RS18090 (3736146) | 3736146..3736460 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
PQP10_RS18095 (3736491) | 3736491..3737072 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
PQP10_RS18100 (3737391) | 3737391..3737723 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
PQP10_RS18105 (3737769) | 3737769..3739118 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PQP10_RS18110 (3739115) | 3739115..3739774 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
PQP10_RS18115 (3739926) | 3739926..3740318 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PQP10_RS18120 (3740371) | 3740371..3740853 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PQP10_RS18125 (3741058) | 3741058..3741354 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PQP10_RS18130 (3741356) | 3741356..3741751 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PQP10_RS18135 (3741884) | 3741884..3743491 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
PQP10_RS18140 (3743629) | 3743629..3745887 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T269598 WP_000415584.1 NZ_CP116976:3741058-3741354 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT269598 WP_000650107.1 NZ_CP116976:3741356-3741751 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|