Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3676587..3677314 | Replicon | chromosome |
| Accession | NZ_CP116976 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PQP10_RS17820 | Protein ID | WP_000550189.1 |
| Coordinates | 3676587..3676901 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP10_RS17825 | Protein ID | WP_000560255.1 |
| Coordinates | 3676898..3677314 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS17800 (3672753) | 3672753..3673739 | - | 987 | WP_094337096.1 | Gfo/Idh/MocA family oxidoreductase | - |
| PQP10_RS17805 (3673818) | 3673818..3674501 | - | 684 | WP_001183041.1 | vancomycin high temperature exclusion protein | - |
| PQP10_RS17810 (3674578) | 3674578..3675081 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| PQP10_RS17815 (3675166) | 3675166..3676302 | + | 1137 | WP_000018690.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PQP10_RS17820 (3676587) | 3676587..3676901 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PQP10_RS17825 (3676898) | 3676898..3677314 | + | 417 | WP_000560255.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PQP10_RS17830 (3677359) | 3677359..3679377 | - | 2019 | WP_272771635.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PQP10_RS17835 (3679703) | 3679703..3682054 | - | 2352 | WP_000695495.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T269597 WP_000550189.1 NZ_CP116976:3676587-3676901 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14951.41 Da Isoelectric Point: 4.5577
>AT269597 WP_000560255.1 NZ_CP116976:3676898-3677314 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|