Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36057..36326 | Replicon | plasmid pCUVM3.4 |
Accession | NZ_CP116974 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | PQP09_RS26290 | Protein ID | WP_001372321.1 |
Coordinates | 36201..36326 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 36057..36122 (-) |
Genomic Context
Location: 31767..32294 (528 bp)
Type: Others
Protein ID: WP_000290834.1
Type: Others
Protein ID: WP_000290834.1
Location: 32352..32585 (234 bp)
Type: Others
Protein ID: WP_000006003.1
Type: Others
Protein ID: WP_000006003.1
Location: 32646..34669 (2024 bp)
Type: Others
Protein ID: Protein_43
Type: Others
Protein ID: Protein_43
Location: 34738..35172 (435 bp)
Type: Others
Protein ID: WP_000845953.1
Type: Others
Protein ID: WP_000845953.1
Location: 35169..35931 (763 bp)
Type: Others
Protein ID: Protein_45
Type: Others
Protein ID: Protein_45
Location: 35900..36124 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 35900..36124 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 35900..36124 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 35900..36124 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 36110..36259 (150 bp)
Type: Others
Protein ID: Protein_47
Type: Others
Protein ID: Protein_47
Location: 36201..36326 (126 bp)
Type: Toxin
Protein ID: WP_001372321.1
Type: Toxin
Protein ID: WP_001372321.1
Location: 39953..40249 (297 bp)
Type: Others
Protein ID: WP_001272251.1
Type: Others
Protein ID: WP_001272251.1
Location: 40360..41181 (822 bp)
Type: Others
Protein ID: WP_001234445.1
Type: Others
Protein ID: WP_001234445.1
Location: 35909..36088 (180 bp)
Type: Others
Protein ID: WP_001309233.1
Type: Others
Protein ID: WP_001309233.1
Location: 36057..36122 (66 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 36628..38199 (1572 bp)
Type: Others
Protein ID: WP_094083869.1
Type: Others
Protein ID: WP_094083869.1
Location: 38219..38566 (348 bp)
Type: Others
Protein ID: WP_000624622.1
Type: Others
Protein ID: WP_000624622.1
Location: 38566..39216 (651 bp)
Type: Others
Protein ID: WP_000993956.1
Type: Others
Protein ID: WP_000993956.1
Location: 39357..39653 (297 bp)
Type: Others
Protein ID: Protein_52
Type: Others
Protein ID: Protein_52
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS26255 | 31767..32294 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
PQP09_RS26260 | 32352..32585 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
PQP09_RS26265 | 32646..34669 | + | 2024 | Protein_43 | ParB/RepB/Spo0J family partition protein | - |
PQP09_RS26270 | 34738..35172 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
PQP09_RS26275 | 35169..35931 | + | 763 | Protein_45 | plasmid SOS inhibition protein A | - |
- | 35900..36124 | + | 225 | NuclAT_0 | - | - |
- | 35900..36124 | + | 225 | NuclAT_0 | - | - |
- | 35900..36124 | + | 225 | NuclAT_0 | - | - |
- | 35900..36124 | + | 225 | NuclAT_0 | - | - |
PQP09_RS26280 | 35909..36088 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 36057..36122 | - | 66 | - | - | Antitoxin |
PQP09_RS26285 | 36110..36259 | + | 150 | Protein_47 | plasmid maintenance protein Mok | - |
PQP09_RS26290 | 36201..36326 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
PQP09_RS26295 | 36628..38199 | - | 1572 | WP_094083869.1 | IS66-like element ISCro1 family transposase | - |
PQP09_RS26300 | 38219..38566 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
PQP09_RS26305 | 38566..39216 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
PQP09_RS26310 | 39357..39653 | - | 297 | Protein_52 | hypothetical protein | - |
PQP09_RS26315 | 39953..40249 | + | 297 | WP_001272251.1 | hypothetical protein | - |
PQP09_RS26320 | 40360..41181 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T269584 WP_001372321.1 NZ_CP116974:36201-36326 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT269584 NZ_CP116974:c36122-36057 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Download structure file