Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 55432..55696 | Replicon | plasmid pCUVM3.2 |
| Accession | NZ_CP116972 | ||
| Organism | Escherichia coli strain CUVM3 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | PQP09_RS25305 | Protein ID | WP_001303307.1 |
| Coordinates | 55544..55696 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 55432..55494 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP09_RS25285 (51332) | 51332..52540 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| PQP09_RS25290 (52722) | 52722..54293 | - | 1572 | WP_094083869.1 | IS66-like element ISCro1 family transposase | - |
| PQP09_RS25295 (54313) | 54313..54660 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PQP09_RS25300 (54660) | 54660..55310 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| - (55432) | 55432..55494 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (55432) | 55432..55494 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (55432) | 55432..55494 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (55432) | 55432..55494 | - | 63 | NuclAT_0 | - | Antitoxin |
| PQP09_RS25305 (55544) | 55544..55696 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| PQP09_RS25310 (55768) | 55768..56019 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| - (56406) | 56406..56457 | - | 52 | NuclAT_1 | - | - |
| - (56406) | 56406..56457 | - | 52 | NuclAT_1 | - | - |
| - (56406) | 56406..56457 | - | 52 | NuclAT_1 | - | - |
| - (56406) | 56406..56457 | - | 52 | NuclAT_1 | - | - |
| PQP09_RS25315 (56943) | 56943..57119 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| PQP09_RS25320 (57511) | 57511..57720 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PQP09_RS25325 (57792) | 57792..58454 | - | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PQP09_RS25330 (58525) | 58525..60693 | - | 2169 | WP_000698368.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-2 | - | 1..101216 | 101216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T269580 WP_001303307.1 NZ_CP116972:55544-55696 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T269580 NZ_CP116972:55544-55696 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT269580 NZ_CP116972:c55494-55432 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|