Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 90735..90989 | Replicon | plasmid pCUVM3.1 |
| Accession | NZ_CP116971 | ||
| Organism | Escherichia coli strain CUVM3 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | PQP09_RS24535 | Protein ID | WP_074152653.1 |
| Coordinates | 90735..90884 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 90928..90989 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP09_RS24485 (85785) | 85785..86936 | - | 1152 | WP_272784612.1 | IS30-like element IS30 family transposase | - |
| PQP09_RS24490 (87004) | 87004..87306 | - | 303 | Protein_86 | transposase | - |
| PQP09_RS24495 (87342) | 87342..87539 | - | 198 | Protein_87 | 3'-5' exonuclease | - |
| PQP09_RS24500 (87579) | 87579..87857 | - | 279 | WP_001384452.1 | type II toxin-antitoxin system toxin YacB | - |
| PQP09_RS24505 (87857) | 87857..88126 | - | 270 | WP_000079923.1 | type II toxin-antitoxin system antitoxin YacA | - |
| PQP09_RS24510 (88199) | 88199..88339 | - | 141 | WP_162777809.1 | hypothetical protein | - |
| PQP09_RS24515 (89033) | 89033..89889 | - | 857 | Protein_91 | incFII family plasmid replication initiator RepA | - |
| PQP09_RS24520 (89882) | 89882..89956 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| PQP09_RS24525 (90005) | 90005..90130 | + | 126 | WP_001436741.1 | hypothetical protein | - |
| PQP09_RS24530 (90203) | 90203..90451 | - | 249 | WP_000083838.1 | replication regulatory protein RepA | - |
| PQP09_RS24535 (90735) | 90735..90884 | - | 150 | WP_074152653.1 | Hok/Gef family protein | Toxin |
| - (90928) | 90928..90989 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (90928) | 90928..90989 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (90928) | 90928..90989 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (90928) | 90928..90989 | + | 62 | NuclAT_1 | - | Antitoxin |
| PQP09_RS24540 (91248) | 91248..91547 | - | 300 | WP_050593763.1 | hypothetical protein | - |
| PQP09_RS24545 (91665) | 91665..92111 | - | 447 | WP_063115548.1 | thermonuclease family protein | - |
| PQP09_RS24550 (92249) | 92249..93862 | - | 1614 | WP_047063389.1 | IS66-like element ISEc23 family transposase | - |
| PQP09_RS24555 (93893) | 93893..94243 | - | 351 | WP_001565133.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PQP09_RS24560 (94240) | 94240..94665 | - | 426 | WP_000422741.1 | transposase | - |
| PQP09_RS24565 (95394) | 95394..95597 | - | 204 | WP_001327131.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..164599 | 164599 | |
| - | inside | IScluster/Tn | - | - | 83497..94665 | 11168 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5558.67 Da Isoelectric Point: 8.7678
>T269573 WP_074152653.1 NZ_CP116971:c90884-90735 [Escherichia coli]
MTKYTLIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269573 NZ_CP116971:90928-90989 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
