Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3267312..3267914 | Replicon | chromosome |
| Accession | NZ_CP116970 | ||
| Organism | Escherichia coli strain CUVM3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PQP09_RS16225 | Protein ID | WP_000897305.1 |
| Coordinates | 3267312..3267623 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP09_RS16230 | Protein ID | WP_000356397.1 |
| Coordinates | 3267624..3267914 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP09_RS16195 (3262342) | 3262342..3263127 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP09_RS16200 (3263226) | 3263226..3263825 | + | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
| PQP09_RS16205 (3263819) | 3263819..3264691 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PQP09_RS16210 (3264688) | 3264688..3265125 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| PQP09_RS16215 (3265170) | 3265170..3266111 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PQP09_RS16220 (3266175) | 3266175..3267083 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| PQP09_RS16225 (3267312) | 3267312..3267623 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PQP09_RS16230 (3267624) | 3267624..3267914 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PQP09_RS16235 (3268519) | 3268519..3268737 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| PQP09_RS16240 (3268956) | 3268956..3269198 | + | 243 | WP_001086388.1 | protein YiiF | - |
| PQP09_RS16245 (3269528) | 3269528..3270457 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP09_RS16250 (3270454) | 3270454..3271089 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP09_RS16255 (3271086) | 3271086..3271988 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269566 WP_000897305.1 NZ_CP116970:3267312-3267623 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|