Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2469602..2470401 | Replicon | chromosome |
Accession | NZ_CP116970 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | PQP09_RS12330 | Protein ID | WP_000347267.1 |
Coordinates | 2469937..2470401 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PQP09_RS12325 | Protein ID | WP_001307405.1 |
Coordinates | 2469602..2469937 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS12310 (2465387) | 2465387..2466157 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PQP09_RS12315 (2466173) | 2466173..2467507 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
PQP09_RS12320 (2467882) | 2467882..2469453 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
PQP09_RS12325 (2469602) | 2469602..2469937 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PQP09_RS12330 (2469937) | 2469937..2470401 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PQP09_RS12335 (2470456) | 2470456..2471265 | - | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
PQP09_RS12340 (2471514) | 2471514..2472794 | + | 1281 | WP_000681947.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PQP09_RS12345 (2472817) | 2472817..2473290 | + | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PQP09_RS12350 (2473301) | 2473301..2474080 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PQP09_RS12355 (2474070) | 2474070..2474948 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PQP09_RS12360 (2474966) | 2474966..2475400 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2457335..2470401 | 13066 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T269563 WP_000347267.1 NZ_CP116970:2469937-2470401 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |