Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 51787..52029 | Replicon | plasmid pDM86-optrA |
Accession | NZ_CP116964 | ||
Organism | Enterococcus faecalis strain DM86 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PO880_RS15140 | Protein ID | WP_002360667.1 |
Coordinates | 51787..51897 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 51938..52029 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO880_RS15095 (46957) | 46957..47616 | + | 660 | WP_002386513.1 | hypothetical protein | - |
PO880_RS15100 (47698) | 47698..48318 | + | 621 | WP_161978277.1 | recombinase family protein | - |
PO880_RS15105 (48308) | 48308..48622 | + | 315 | WP_002390465.1 | hypothetical protein | - |
PO880_RS15110 (48616) | 48616..48840 | + | 225 | WP_002358271.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
PO880_RS15115 (48909) | 48909..49109 | + | 201 | WP_002390466.1 | hypothetical protein | - |
PO880_RS15120 (49130) | 49130..49432 | + | 303 | WP_128713120.1 | DUF6440 family protein | - |
PO880_RS15125 (49861) | 49861..51189 | + | 1329 | WP_138807346.1 | ultraviolet resistance protein UvrA | - |
PO880_RS15130 (51186) | 51186..51536 | + | 351 | WP_002360672.1 | hypothetical protein | - |
PO880_RS15135 (51493) | 51493..51705 | + | 213 | WP_138807350.1 | excinuclease ABC subunit C | - |
PO880_RS15140 (51787) | 51787..51897 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (51938) | 51938..52029 | - | 92 | NuclAT_0 | - | Antitoxin |
- (51938) | 51938..52029 | - | 92 | NuclAT_0 | - | Antitoxin |
- (51938) | 51938..52029 | - | 92 | NuclAT_0 | - | Antitoxin |
- (51938) | 51938..52029 | - | 92 | NuclAT_0 | - | Antitoxin |
PO880_RS15145 (52138) | 52138..52434 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
PO880_RS15150 (52688) | 52688..53470 | + | 783 | WP_002360664.1 | ParA family protein | - |
PO880_RS15155 (53463) | 53463..53819 | + | 357 | WP_128713114.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aac(6')-aph(2'') / aph(2'')-Ia / erm(A) / optrA / fexA / aadD / ant(9)-Ia | - | 1..54078 | 54078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T269551 WP_002360667.1 NZ_CP116964:51787-51897 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT269551 NZ_CP116964:c52029-51938 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|