Detailed information of TA system TA269549

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): fst-RNAII/Fst(toxin)
• Location: 51787..52002
• Replicon: plasmid pDM86-optrA
• Accession: NZ_CP116964
• Organism: Enterococcus faecalis strain DM86

Toxin (Protein)

• Gene name: fst
• Uniprot ID: -
• Locus tag: PO880_RS15140
• Protein ID: WP_002360667.1
• Coordinates: 51787..51897 (+)
• Length: 37 a.a.

Antitoxin (RNA)

Gene name	RNAII
Locus tag	-
Coordinates	51938..52002 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PO880_RS15095	46957..47616	+	660	WP_002386513.1	hypothetical protein	-
PO880_RS15100	47698..48318	+	621	WP_161978277.1	recombinase family protein	-
PO880_RS15105	48308..48622	+	315	WP_002390465.1	hypothetical protein	-
PO880_RS15110	48616..48840	+	225	WP_002358271.1	ultraviolet resistance protein UvrA repressor UvrC	-
PO880_RS15115	48909..49109	+	201	WP_002390466.1	hypothetical protein	-
PO880_RS15120	49130..49432	+	303	WP_128713120.1	DUF6440 family protein	-
PO880_RS15125	49861..51189	+	1329	WP_138807346.1	ultraviolet resistance protein UvrA	-
PO880_RS15130	51186..51536	+	351	WP_002360672.1	hypothetical protein	-
PO880_RS15135	51493..51705	+	213	WP_138807350.1	excinuclease ABC subunit C	-
PO880_RS15140	51787..51897	+	111	WP_002360667.1	type I toxin-antitoxin system Fst family toxin	Toxin
-	51938..52002	-	65	-	-	Antitoxin
PO880_RS15145	52138..52434	+	297	WP_002360665.1	replication control protein PrgN	-
PO880_RS15150	52688..53470	+	783	WP_002360664.1	ParA family protein	-
PO880_RS15155	53463..53819	+	357	WP_128713114.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	aac(6')-aph(2'') / aph(2'')-Ia / erm(A) / optrA / fexA / aadD / ant(9)-Ia	-	1..54078	54078

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 37 a.a.
• Molecular weight: 4117.92 Da
• Isoelectric Point: 4.1672

>T269549 WP_002360667.1 NZ_CP116964:51787-51897 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Nucleotide

• Length: 111 bp

Antitoxin

Nucleotide

• Length: 65 bp

>AT269549 NZ_CP116964:c52002-51938 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Structures

Antitoxin