Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2817003..2817198 | Replicon | chromosome |
Accession | NZ_CP116962 | ||
Organism | Enterococcus faecalis strain DM86 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PO880_RS13585 | Protein ID | WP_015543884.1 |
Coordinates | 2817003..2817098 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2817133..2817198 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO880_RS13565 | 2812181..2813296 | + | 1116 | WP_010710823.1 | FAD-dependent oxidoreductase | - |
PO880_RS13570 | 2813364..2814518 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
PO880_RS13575 | 2814533..2814970 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
PO880_RS13580 | 2814985..2816757 | - | 1773 | WP_010710824.1 | PTS mannitol-specific transporter subunit IIBC | - |
PO880_RS13585 | 2817003..2817098 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2817133..2817198 | - | 66 | - | - | Antitoxin |
PO880_RS13590 | 2817369..2817803 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
PO880_RS13595 | 2817814..2819847 | - | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
PO880_RS13600 | 2819838..2821580 | - | 1743 | WP_010710825.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T269547 WP_015543884.1 NZ_CP116962:2817003-2817098 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT269547 NZ_CP116962:c2817198-2817133 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|