Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2723456..2723990 Replicon chromosome
Accession NZ_CP116962
Organism Enterococcus faecalis strain DM86

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag PO880_RS13095 Protein ID WP_002360769.1
Coordinates 2723456..2723731 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag PO880_RS13100 Protein ID WP_002369771.1
Coordinates 2723724..2723990 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO880_RS13065 (2718504) 2718504..2719442 - 939 WP_002370935.1 2-dehydropantoate 2-reductase -
PO880_RS13070 (2719570) 2719570..2719899 - 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
PO880_RS13075 (2719929) 2719929..2720114 + 186 WP_002358660.1 hypothetical protein -
PO880_RS13080 (2720146) 2720146..2720754 + 609 Protein_2563 IS6 family transposase -
PO880_RS13085 (2721423) 2721423..2722397 - 975 WP_002355428.1 choloylglycine hydrolase -
PO880_RS13090 (2722621) 2722621..2723265 + 645 WP_002377952.1 IS6 family transposase -
PO880_RS13095 (2723456) 2723456..2723731 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
PO880_RS13100 (2723724) 2723724..2723990 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PO880_RS13105 (2724101) 2724101..2724685 - 585 WP_272731505.1 thermonuclease family protein -
PO880_RS13110 (2724709) 2724709..2725125 - 417 WP_272731507.1 single-stranded DNA-binding protein -
PO880_RS13115 (2725201) 2725201..2725449 - 249 WP_002360773.1 DUF3850 domain-containing protein -
PO880_RS13120 (2725462) 2725462..2725962 - 501 WP_002360775.1 DnaJ domain-containing protein -
PO880_RS13125 (2725995) 2725995..2726261 - 267 WP_002377947.1 hypothetical protein -
PO880_RS13130 (2726853) 2726853..2727341 - 489 WP_010710133.1 hypothetical protein -
PO880_RS13135 (2727347) 2727347..2727940 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh 2680143..2743598 63455


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T269546 WP_002360769.1 NZ_CP116962:c2723731-2723456 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT269546 WP_002369771.1 NZ_CP116962:c2723990-2723724 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References