Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 69835..70427 | Replicon | plasmid p2939_90_1 |
Accession | NZ_CP116944 | ||
Organism | Providencia alcalifaciens strain 2939/90 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6L6F789 |
Locus tag | PO864_RS19770 | Protein ID | WP_036954335.1 |
Coordinates | 70149..70427 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6L6F9S8 |
Locus tag | PO864_RS19765 | Protein ID | WP_036961084.1 |
Coordinates | 69835..70149 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO864_RS19755 (PO864_19960) | 67498..68874 | - | 1377 | WP_036974601.1 | conjugal transfer pilus assembly protein TraH | - |
PO864_RS19760 (PO864_19965) | 69286..69637 | + | 352 | Protein_51 | transposase | - |
PO864_RS19765 (PO864_19970) | 69835..70149 | - | 315 | WP_036961084.1 | HigA family addiction module antitoxin | Antitoxin |
PO864_RS19770 (PO864_19975) | 70149..70427 | - | 279 | WP_036954335.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PO864_RS19775 (PO864_19980) | 70460..71041 | - | 582 | WP_282490695.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
PO864_RS19780 (PO864_19985) | 71020..71340 | - | 321 | WP_282490697.1 | hypothetical protein | - |
PO864_RS19785 (PO864_19990) | 71351..72142 | - | 792 | Protein_56 | type-F conjugative transfer system pilin assembly protein TraF | - |
PO864_RS19790 (PO864_20000) | 72174..72821 | - | 648 | WP_282490698.1 | conjugal transfer protein TraN | - |
PO864_RS19795 (PO864_20005) | 72718..73809 | - | 1092 | WP_282490699.1 | hypothetical protein | - |
PO864_RS19800 (PO864_20010) | 73770..74522 | - | 753 | WP_282490701.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | sicA / spaS / spaQ / spaP / invC/sctN / invA / espC / prgK / prgI | 1..127696 | 127696 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10857.23 Da Isoelectric Point: 8.4391
>T269519 WP_036954335.1 NZ_CP116944:c70427-70149 [Providencia alcalifaciens]
MIKSFKHKGLKQLFEKGNTSGVPAQDAERINDRLQAIDTANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
MIKSFKHKGLKQLFEKGNTSGVPAQDAERINDRLQAIDTANDIRELDRQIYKLHPLKGDREGYWSITVRANWRITFQFIN
GDAYILNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L6F789 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L6F9S8 |