Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4762439..4763041 | Replicon | chromosome |
| Accession | NZ_CP116931 | ||
| Organism | Escherichia coli strain MLI106K1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NL422_RS23450 | Protein ID | WP_000897305.1 |
| Coordinates | 4762730..4763041 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL422_RS23445 | Protein ID | WP_000356395.1 |
| Coordinates | 4762439..4762729 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL422_RS23410 (4758063) | 4758063..4758965 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NL422_RS23415 (4758962) | 4758962..4759597 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL422_RS23420 (4759594) | 4759594..4760523 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NL422_RS23425 (4760705) | 4760705..4760947 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| NL422_RS23430 (4761166) | 4761166..4761384 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NL422_RS23435 (4761803) | 4761803..4762081 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| NL422_RS23440 (4762133) | 4762133..4762354 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| NL422_RS23445 (4762439) | 4762439..4762729 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| NL422_RS23450 (4762730) | 4762730..4763041 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NL422_RS23455 (4763270) | 4763270..4764178 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| NL422_RS23460 (4764346) | 4764346..4765260 | - | 915 | WP_109553727.1 | transposase | - |
| NL422_RS23465 (4765273) | 4765273..4766160 | - | 888 | Protein_4453 | hypothetical protein | - |
| NL422_RS23470 (4766576) | 4766576..4767517 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NL422_RS23475 (4767562) | 4767562..4767999 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269513 WP_000897305.1 NZ_CP116931:c4763041-4762730 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|