Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3860811..3861505 | Replicon | chromosome |
| Accession | NZ_CP116931 | ||
| Organism | Escherichia coli strain MLI106K1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NL422_RS19270 | Protein ID | WP_001263491.1 |
| Coordinates | 3860811..3861209 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NL422_RS19275 | Protein ID | WP_000554755.1 |
| Coordinates | 3861212..3861505 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3856640) | 3856640..3856720 | - | 81 | NuclAT_11 | - | - |
| - (3856640) | 3856640..3856720 | - | 81 | NuclAT_11 | - | - |
| - (3856640) | 3856640..3856720 | - | 81 | NuclAT_11 | - | - |
| - (3856640) | 3856640..3856720 | - | 81 | NuclAT_11 | - | - |
| NL422_RS19240 (3855980) | 3855980..3857224 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NL422_RS19245 (3857316) | 3857316..3857774 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NL422_RS19250 (3858035) | 3858035..3859492 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NL422_RS19255 (3859549) | 3859549..3859901 | - | 353 | Protein_3638 | peptide chain release factor H | - |
| NL422_RS19260 (3859897) | 3859897..3860103 | - | 207 | Protein_3639 | RtcB family protein | - |
| NL422_RS19265 (3860349) | 3860349..3860801 | - | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| NL422_RS19270 (3860811) | 3860811..3861209 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NL422_RS19275 (3861212) | 3861212..3861505 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NL422_RS19280 (3861557) | 3861557..3862612 | - | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| NL422_RS19285 (3862683) | 3862683..3863468 | - | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| NL422_RS19290 (3863440) | 3863440..3865152 | + | 1713 | Protein_3645 | flagellar biosynthesis protein FlhA | - |
| NL422_RS19295 (3865257) | 3865257..3865535 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NL422_RS19300 (3865528) | 3865528..3865884 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3808839..3861505 | 52666 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T269509 WP_001263491.1 NZ_CP116931:c3861209-3860811 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |