Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3860811..3861505 Replicon chromosome
Accession NZ_CP116931
Organism Escherichia coli strain MLI106K1

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NL422_RS19270 Protein ID WP_001263491.1
Coordinates 3860811..3861209 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL422_RS19275 Protein ID WP_000554755.1
Coordinates 3861212..3861505 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3856640) 3856640..3856720 - 81 NuclAT_11 - -
- (3856640) 3856640..3856720 - 81 NuclAT_11 - -
- (3856640) 3856640..3856720 - 81 NuclAT_11 - -
- (3856640) 3856640..3856720 - 81 NuclAT_11 - -
NL422_RS19240 (3855980) 3855980..3857224 - 1245 WP_000189541.1 esterase FrsA -
NL422_RS19245 (3857316) 3857316..3857774 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL422_RS19250 (3858035) 3858035..3859492 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL422_RS19255 (3859549) 3859549..3859901 - 353 Protein_3638 peptide chain release factor H -
NL422_RS19260 (3859897) 3859897..3860103 - 207 Protein_3639 RtcB family protein -
NL422_RS19265 (3860349) 3860349..3860801 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NL422_RS19270 (3860811) 3860811..3861209 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL422_RS19275 (3861212) 3861212..3861505 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL422_RS19280 (3861557) 3861557..3862612 - 1056 WP_001550655.1 DNA polymerase IV -
NL422_RS19285 (3862683) 3862683..3863468 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NL422_RS19290 (3863440) 3863440..3865152 + 1713 Protein_3645 flagellar biosynthesis protein FlhA -
NL422_RS19295 (3865257) 3865257..3865535 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NL422_RS19300 (3865528) 3865528..3865884 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 3808839..3861505 52666


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T269509 WP_001263491.1 NZ_CP116931:c3861209-3860811 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269509 WP_000554755.1 NZ_CP116931:c3861505-3861212 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References