Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1130916..1131643 | Replicon | chromosome |
| Accession | NZ_CP116931 | ||
| Organism | Escherichia coli strain MLI106K1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | NL422_RS06065 | Protein ID | WP_000547555.1 |
| Coordinates | 1130916..1131227 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL422_RS06070 | Protein ID | WP_000126294.1 |
| Coordinates | 1131224..1131643 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL422_RS06040 (1126851) | 1126851..1128560 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| NL422_RS06045 (1128570) | 1128570..1129112 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| NL422_RS06050 (1129112) | 1129112..1129879 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NL422_RS06055 (1129876) | 1129876..1130286 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| NL422_RS06060 (1130279) | 1130279..1130749 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NL422_RS06065 (1130916) | 1130916..1131227 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL422_RS06070 (1131224) | 1131224..1131643 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NL422_RS06075 (1131722) | 1131722..1133146 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| NL422_RS06080 (1133155) | 1133155..1134612 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NL422_RS06085 (1134872) | 1134872..1135882 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| NL422_RS06090 (1136031) | 1136031..1136558 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T269496 WP_000547555.1 NZ_CP116931:1130916-1131227 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT269496 WP_000126294.1 NZ_CP116931:1131224-1131643 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|