Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3528607..3529301 | Replicon | chromosome |
Accession | NZ_CP116929 | ||
Organism | Escherichia coli strain MLI105 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NL421_RS17575 | Protein ID | WP_001263489.1 |
Coordinates | 3528607..3529005 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NL421_RS17580 | Protein ID | WP_000554758.1 |
Coordinates | 3529008..3529301 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3524195) | 3524195..3524275 | - | 81 | NuclAT_13 | - | - |
- (3524195) | 3524195..3524275 | - | 81 | NuclAT_13 | - | - |
- (3524195) | 3524195..3524275 | - | 81 | NuclAT_13 | - | - |
- (3524195) | 3524195..3524275 | - | 81 | NuclAT_13 | - | - |
NL421_RS17550 (3524871) | 3524871..3525329 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NL421_RS17555 (3525590) | 3525590..3527047 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NL421_RS17560 (3527104) | 3527104..3527625 | - | 522 | Protein_3401 | peptide chain release factor H | - |
NL421_RS17565 (3527621) | 3527621..3527827 | - | 207 | Protein_3402 | RtcB family protein | - |
NL421_RS17570 (3528145) | 3528145..3528597 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NL421_RS17575 (3528607) | 3528607..3529005 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NL421_RS17580 (3529008) | 3529008..3529301 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NL421_RS17585 (3529353) | 3529353..3530408 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NL421_RS17590 (3530479) | 3530479..3531264 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NL421_RS17595 (3531236) | 3531236..3532948 | + | 1713 | Protein_3408 | flagellar biosynthesis protein FlhA | - |
NL421_RS17600 (3533172) | 3533172..3533669 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3478403..3534471 | 56068 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T269487 WP_001263489.1 NZ_CP116929:c3529005-3528607 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |