Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3827626..3828320 | Replicon | chromosome |
| Accession | NZ_CP116925 | ||
| Organism | Escherichia coli strain MLI104K2 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | NL420_RS19665 | Protein ID | WP_115223466.1 |
| Coordinates | 3827626..3828024 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | NL420_RS19670 | Protein ID | WP_000554757.1 |
| Coordinates | 3828027..3828320 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3823286) | 3823286..3823366 | - | 81 | NuclAT_10 | - | - |
| - (3823286) | 3823286..3823366 | - | 81 | NuclAT_10 | - | - |
| - (3823286) | 3823286..3823366 | - | 81 | NuclAT_10 | - | - |
| - (3823286) | 3823286..3823366 | - | 81 | NuclAT_10 | - | - |
| NL420_RS19635 (3822626) | 3822626..3823870 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NL420_RS19640 (3823962) | 3823962..3824420 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NL420_RS19645 (3824681) | 3824681..3826138 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| NL420_RS19650 (3826195) | 3826195..3826716 | - | 522 | Protein_3746 | peptide chain release factor H | - |
| NL420_RS19655 (3826715) | 3826715..3826918 | - | 204 | Protein_3747 | RtcB family protein | - |
| NL420_RS19660 (3827164) | 3827164..3827616 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| NL420_RS19665 (3827626) | 3827626..3828024 | - | 399 | WP_115223466.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NL420_RS19670 (3828027) | 3828027..3828320 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NL420_RS19675 (3828372) | 3828372..3829427 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NL420_RS19680 (3829498) | 3829498..3830283 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| NL420_RS19685 (3830255) | 3830255..3831967 | + | 1713 | Protein_3753 | flagellar biosynthesis protein FlhA | - |
| NL420_RS19690 (3832191) | 3832191..3832688 | - | 498 | WP_072667535.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15454.80 Da Isoelectric Point: 8.0949
>T269468 WP_115223466.1 NZ_CP116925:c3828024-3827626 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRIRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRIRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|