Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47407..47671 | Replicon | plasmid p93_MLI104-2 |
| Accession | NZ_CP116924 | ||
| Organism | Escherichia coli strain MLI104K2 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | NL420_RS00255 | Protein ID | WP_001331364.1 |
| Coordinates | 47407..47559 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 47609..47671 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL420_RS00225 (42900) | 42900..45067 | + | 2168 | Protein_44 | IncI1-type conjugal transfer membrane protein TraY | - |
| NL420_RS00230 (45143) | 45143..45757 | + | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NL420_RS00235 (45855) | 45855..46064 | + | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| NL420_RS00240 (46247) | 46247..46423 | + | 177 | WP_001054898.1 | hypothetical protein | - |
| NL420_RS00245 (46488) | 46488..46583 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| NL420_RS00250 (47084) | 47084..47335 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| NL420_RS00255 (47407) | 47407..47559 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (47609) | 47609..47671 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (47609) | 47609..47671 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (47609) | 47609..47671 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (47609) | 47609..47671 | + | 63 | NuclAT_0 | - | Antitoxin |
| NL420_RS00260 (47880) | 47880..48791 | + | 912 | WP_272781916.1 | hypothetical protein | - |
| NL420_RS00265 (49270) | 49270..50478 | + | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
| NL420_RS00270 (50497) | 50497..51567 | + | 1071 | WP_031942445.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / blaCTX-M-15 | - | 1..93511 | 93511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T269448 WP_001331364.1 NZ_CP116924:c47559-47407 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT269448 NZ_CP116924:47609-47671 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|