Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 47407..47671 Replicon plasmid p93_MLI104-2
Accession NZ_CP116924
Organism Escherichia coli strain MLI104K2

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NL420_RS00255 Protein ID WP_001331364.1
Coordinates 47407..47559 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 47609..47671 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL420_RS00225 (42900) 42900..45067 + 2168 Protein_44 IncI1-type conjugal transfer membrane protein TraY -
NL420_RS00230 (45143) 45143..45757 + 615 WP_000578648.1 plasmid IncI1-type surface exclusion protein ExcA -
NL420_RS00235 (45855) 45855..46064 + 210 WP_001140543.1 hemolysin expression modulator Hha -
NL420_RS00240 (46247) 46247..46423 + 177 WP_001054898.1 hypothetical protein -
NL420_RS00245 (46488) 46488..46583 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
NL420_RS00250 (47084) 47084..47335 + 252 WP_001291964.1 hypothetical protein -
NL420_RS00255 (47407) 47407..47559 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (47609) 47609..47671 + 63 NuclAT_0 - Antitoxin
- (47609) 47609..47671 + 63 NuclAT_0 - Antitoxin
- (47609) 47609..47671 + 63 NuclAT_0 - Antitoxin
- (47609) 47609..47671 + 63 NuclAT_0 - Antitoxin
NL420_RS00260 (47880) 47880..48791 + 912 WP_272781916.1 hypothetical protein -
NL420_RS00265 (49270) 49270..50478 + 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
NL420_RS00270 (50497) 50497..51567 + 1071 WP_031942445.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / blaCTX-M-15 - 1..93511 93511


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T269448 WP_001331364.1 NZ_CP116924:c47559-47407 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT269448 NZ_CP116924:47609-47671 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References