Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3721953..3722647 | Replicon | chromosome |
| Accession | NZ_CP116923 | ||
| Organism | Escherichia coli strain MLI104K1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | NL419_RS19045 | Protein ID | WP_115223466.1 |
| Coordinates | 3721953..3722351 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | NL419_RS19050 | Protein ID | WP_000554757.1 |
| Coordinates | 3722354..3722647 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3717613) | 3717613..3717693 | - | 81 | NuclAT_10 | - | - |
| - (3717613) | 3717613..3717693 | - | 81 | NuclAT_10 | - | - |
| - (3717613) | 3717613..3717693 | - | 81 | NuclAT_10 | - | - |
| - (3717613) | 3717613..3717693 | - | 81 | NuclAT_10 | - | - |
| NL419_RS19015 (3716953) | 3716953..3718197 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NL419_RS19020 (3718289) | 3718289..3718747 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NL419_RS19025 (3719008) | 3719008..3720465 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| NL419_RS19030 (3720522) | 3720522..3721043 | - | 522 | Protein_3633 | peptide chain release factor H | - |
| NL419_RS19035 (3721042) | 3721042..3721245 | - | 204 | Protein_3634 | RtcB family protein | - |
| NL419_RS19040 (3721491) | 3721491..3721943 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| NL419_RS19045 (3721953) | 3721953..3722351 | - | 399 | WP_115223466.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NL419_RS19050 (3722354) | 3722354..3722647 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NL419_RS19055 (3722699) | 3722699..3723754 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NL419_RS19060 (3723825) | 3723825..3724610 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| NL419_RS19065 (3724582) | 3724582..3726294 | + | 1713 | Protein_3640 | flagellar biosynthesis protein FlhA | - |
| NL419_RS19070 (3726518) | 3726518..3727015 | - | 498 | WP_072667535.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15454.80 Da Isoelectric Point: 8.0949
>T269444 WP_115223466.1 NZ_CP116923:c3722351-3721953 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRIRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRIRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|