Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2450971..2451609 | Replicon | chromosome |
Accession | NZ_CP116923 | ||
Organism | Escherichia coli strain MLI104K1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NL419_RS12420 | Protein ID | WP_000813794.1 |
Coordinates | 2451433..2451609 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NL419_RS12415 | Protein ID | WP_001270286.1 |
Coordinates | 2450971..2451387 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL419_RS12395 (2446123) | 2446123..2447064 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
NL419_RS12400 (2447065) | 2447065..2448078 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NL419_RS12405 (2448096) | 2448096..2449241 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NL419_RS12410 (2449486) | 2449486..2450892 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NL419_RS12415 (2450971) | 2450971..2451387 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NL419_RS12420 (2451433) | 2451433..2451609 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NL419_RS12425 (2451831) | 2451831..2452061 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NL419_RS12430 (2452153) | 2452153..2454114 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NL419_RS12435 (2454187) | 2454187..2454723 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NL419_RS12440 (2454815) | 2454815..2455990 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2456030..2457178 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T269441 WP_000813794.1 NZ_CP116923:c2451609-2451433 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269441 WP_001270286.1 NZ_CP116923:c2451387-2450971 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|