Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4029566..4030260 Replicon chromosome
Accession NZ_CP116919
Organism Escherichia coli strain MLI102

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NL418_RS20495 Protein ID WP_001263491.1
Coordinates 4029566..4029964 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL418_RS20500 Protein ID WP_000554755.1
Coordinates 4029967..4030260 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4025395) 4025395..4025475 - 81 NuclAT_9 - -
- (4025395) 4025395..4025475 - 81 NuclAT_9 - -
- (4025395) 4025395..4025475 - 81 NuclAT_9 - -
- (4025395) 4025395..4025475 - 81 NuclAT_9 - -
NL418_RS20465 (4024735) 4024735..4025979 - 1245 WP_000189541.1 esterase FrsA -
NL418_RS20470 (4026071) 4026071..4026529 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL418_RS20475 (4026790) 4026790..4028247 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL418_RS20480 (4028304) 4028304..4028656 - 353 Protein_3876 peptide chain release factor H -
NL418_RS20485 (4028652) 4028652..4028858 - 207 Protein_3877 RtcB family protein -
NL418_RS20490 (4029104) 4029104..4029556 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NL418_RS20495 (4029566) 4029566..4029964 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL418_RS20500 (4029967) 4029967..4030260 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL418_RS20505 (4030312) 4030312..4031367 - 1056 WP_001550655.1 DNA polymerase IV -
NL418_RS20510 (4031438) 4031438..4032223 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NL418_RS20515 (4032195) 4032195..4033907 + 1713 Protein_3883 flagellar biosynthesis protein FlhA -
NL418_RS20520 (4034131) 4034131..4034628 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3996513..4030260 33747


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T269424 WP_001263491.1 NZ_CP116919:c4029964-4029566 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269424 WP_000554755.1 NZ_CP116919:c4030260-4029967 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References