Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3598685..3599379 | Replicon | chromosome |
| Accession | NZ_CP116916 | ||
| Organism | Escherichia coli strain MLI023K2 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | NL417_RS18415 | Protein ID | WP_001263493.1 |
| Coordinates | 3598685..3599083 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | NL417_RS18420 | Protein ID | WP_000554757.1 |
| Coordinates | 3599086..3599379 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3594345) | 3594345..3594425 | - | 81 | NuclAT_11 | - | - |
| - (3594345) | 3594345..3594425 | - | 81 | NuclAT_11 | - | - |
| - (3594345) | 3594345..3594425 | - | 81 | NuclAT_11 | - | - |
| - (3594345) | 3594345..3594425 | - | 81 | NuclAT_11 | - | - |
| NL417_RS18385 (3593685) | 3593685..3594929 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NL417_RS18390 (3595021) | 3595021..3595479 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NL417_RS18395 (3595740) | 3595740..3597197 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| NL417_RS18400 (3597254) | 3597254..3597775 | - | 522 | Protein_3453 | peptide chain release factor H | - |
| NL417_RS18405 (3597774) | 3597774..3597977 | - | 204 | Protein_3454 | RtcB family protein | - |
| NL417_RS18410 (3598223) | 3598223..3598675 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| NL417_RS18415 (3598685) | 3598685..3599083 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NL417_RS18420 (3599086) | 3599086..3599379 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NL417_RS18425 (3599431) | 3599431..3600486 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NL417_RS18430 (3600557) | 3600557..3601480 | - | 924 | WP_087899588.1 | putative lateral flagellar export/assembly protein LafU | - |
| NL417_RS18435 (3601483) | 3601483..3602346 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| NL417_RS18440 (3602359) | 3602359..3603075 | - | 717 | WP_000938730.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| NL417_RS18445 (3603095) | 3603095..3603562 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagW/ecpD / yagV/ecpE | 3556795..3599379 | 42584 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T269408 WP_001263493.1 NZ_CP116916:c3599083-3598685 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|