Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3598685..3599379 Replicon chromosome
Accession NZ_CP116916
Organism Escherichia coli strain MLI023K2

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag NL417_RS18415 Protein ID WP_001263493.1
Coordinates 3598685..3599083 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag NL417_RS18420 Protein ID WP_000554757.1
Coordinates 3599086..3599379 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3594345) 3594345..3594425 - 81 NuclAT_11 - -
- (3594345) 3594345..3594425 - 81 NuclAT_11 - -
- (3594345) 3594345..3594425 - 81 NuclAT_11 - -
- (3594345) 3594345..3594425 - 81 NuclAT_11 - -
NL417_RS18385 (3593685) 3593685..3594929 - 1245 WP_000189541.1 esterase FrsA -
NL417_RS18390 (3595021) 3595021..3595479 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL417_RS18395 (3595740) 3595740..3597197 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
NL417_RS18400 (3597254) 3597254..3597775 - 522 Protein_3453 peptide chain release factor H -
NL417_RS18405 (3597774) 3597774..3597977 - 204 Protein_3454 RtcB family protein -
NL417_RS18410 (3598223) 3598223..3598675 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
NL417_RS18415 (3598685) 3598685..3599083 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL417_RS18420 (3599086) 3599086..3599379 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL417_RS18425 (3599431) 3599431..3600486 - 1056 WP_001226164.1 DNA polymerase IV -
NL417_RS18430 (3600557) 3600557..3601480 - 924 WP_087899588.1 putative lateral flagellar export/assembly protein LafU -
NL417_RS18435 (3601483) 3601483..3602346 - 864 WP_001169518.1 flagellar motor stator protein MotA -
NL417_RS18440 (3602359) 3602359..3603075 - 717 WP_000938730.1 FliA/WhiG family RNA polymerase sigma factor -
NL417_RS18445 (3603095) 3603095..3603562 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagW/ecpD / yagV/ecpE 3556795..3599379 42584


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T269408 WP_001263493.1 NZ_CP116916:c3599083-3598685 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT269408 WP_000554757.1 NZ_CP116916:c3599379-3599086 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References