Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3597906..3598600 Replicon chromosome
Accession NZ_CP116913
Organism Escherichia coli strain MLI023K1

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag NL406_RS18400 Protein ID WP_001263493.1
Coordinates 3597906..3598304 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag NL406_RS18405 Protein ID WP_000554757.1
Coordinates 3598307..3598600 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3593566) 3593566..3593646 - 81 NuclAT_11 - -
- (3593566) 3593566..3593646 - 81 NuclAT_11 - -
- (3593566) 3593566..3593646 - 81 NuclAT_11 - -
- (3593566) 3593566..3593646 - 81 NuclAT_11 - -
NL406_RS18370 (3592906) 3592906..3594150 - 1245 WP_000189541.1 esterase FrsA -
NL406_RS18375 (3594242) 3594242..3594700 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL406_RS18380 (3594961) 3594961..3596418 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
NL406_RS18385 (3596475) 3596475..3596996 - 522 Protein_3450 peptide chain release factor H -
NL406_RS18390 (3596995) 3596995..3597198 - 204 Protein_3451 RtcB family protein -
NL406_RS18395 (3597444) 3597444..3597896 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
NL406_RS18400 (3597906) 3597906..3598304 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL406_RS18405 (3598307) 3598307..3598600 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL406_RS18410 (3598652) 3598652..3599707 - 1056 WP_001226164.1 DNA polymerase IV -
NL406_RS18415 (3599778) 3599778..3600701 - 924 WP_087899588.1 putative lateral flagellar export/assembly protein LafU -
NL406_RS18420 (3600704) 3600704..3601567 - 864 WP_001169518.1 flagellar motor stator protein MotA -
NL406_RS18425 (3601580) 3601580..3602296 - 717 WP_000938730.1 FliA/WhiG family RNA polymerase sigma factor -
NL406_RS18430 (3602316) 3602316..3602783 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagW/ecpD / yagV/ecpE 3556016..3598600 42584


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T269392 WP_001263493.1 NZ_CP116913:c3598304-3597906 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT269392 WP_000554757.1 NZ_CP116913:c3598600-3598307 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References