Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 717160..717853 | Replicon | chromosome |
Accession | NZ_CP116913 | ||
Organism | Escherichia coli strain MLI023K1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NL406_RS04235 | Protein ID | WP_000415584.1 |
Coordinates | 717160..717456 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NL406_RS04240 | Protein ID | WP_000650107.1 |
Coordinates | 717458..717853 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL406_RS04200 (712248) | 712248..712562 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NL406_RS04205 (712593) | 712593..713174 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NL406_RS04210 (713493) | 713493..713825 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
NL406_RS04215 (713871) | 713871..715220 | - | 1350 | WP_187770307.1 | quorum sensing histidine kinase QseC | - |
NL406_RS04220 (715217) | 715217..715876 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NL406_RS04225 (716028) | 716028..716420 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NL406_RS04230 (716473) | 716473..716955 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NL406_RS04235 (717160) | 717160..717456 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NL406_RS04240 (717458) | 717458..717853 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NL406_RS04245 (717986) | 717986..719593 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NL406_RS04250 (719731) | 719731..721989 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T269382 WP_000415584.1 NZ_CP116913:717160-717456 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT269382 WP_000650107.1 NZ_CP116913:717458-717853 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|