Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 652587..653314 | Replicon | chromosome |
| Accession | NZ_CP116913 | ||
| Organism | Escherichia coli strain MLI023K1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1EX98 |
| Locus tag | NL406_RS03930 | Protein ID | WP_000550192.1 |
| Coordinates | 652587..652901 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL406_RS03935 | Protein ID | WP_000560266.1 |
| Coordinates | 652898..653314 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL406_RS03910 (648754) | 648754..649740 | - | 987 | WP_001301393.1 | Gfo/Idh/MocA family oxidoreductase | - |
| NL406_RS03915 (649819) | 649819..650502 | - | 684 | WP_001183046.1 | vancomycin high temperature exclusion protein | - |
| NL406_RS03920 (650579) | 650579..651082 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| NL406_RS03925 (651167) | 651167..652303 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| NL406_RS03930 (652587) | 652587..652901 | + | 315 | WP_000550192.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| NL406_RS03935 (652898) | 652898..653314 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| NL406_RS03940 (653359) | 653359..655377 | - | 2019 | WP_187770297.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| NL406_RS03945 (655803) | 655803..658154 | - | 2352 | WP_061344133.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12063.08 Da Isoelectric Point: 10.0409
>T269381 WP_000550192.1 NZ_CP116913:652587-652901 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTPKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTPKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT269381 WP_000560266.1 NZ_CP116913:652898-653314 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|