Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 925049..925229 | Replicon | chromosome |
| Accession | NZ_CP116909 | ||
| Organism | Staphylococcus aureus strain AATYW | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | LOY12_RS04980 | Protein ID | WP_001801861.1 |
| Coordinates | 925134..925229 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 925049..925106 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY12_RS04950 | 920758..920892 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| LOY12_RS04955 | 921056..922612 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| LOY12_RS04960 | 922605..923834 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| LOY12_RS04965 | 924376..924786 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
| LOY12_RS04970 | 924771..924932 | + | 162 | Protein_940 | transposase | - |
| LOY12_RS04975 | 924910..925011 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 925049..925106 | + | 58 | - | - | Antitoxin |
| LOY12_RS04980 | 925134..925229 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| LOY12_RS04985 | 925374..926386 | + | 1013 | Protein_943 | IS3 family transposase | - |
| LOY12_RS04990 | 926584..927156 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| LOY12_RS04995 | 927257..927598 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| LOY12_RS05000 | 927639..928265 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| LOY12_RS05005 | 928340..929335 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| LOY12_RS05010 | 929416..930066 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / hlgA / lukD | 898216..948853 | 50637 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T269377 WP_001801861.1 NZ_CP116909:c925229-925134 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT269377 NZ_CP116909:925049-925106 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|