Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) txpA-SprF1/-
Location 770585..770892 Replicon chromosome
Accession NZ_CP116909
Organism Staphylococcus aureus strain AATYW

Toxin (Protein)


Gene name txpA Uniprot ID A0A6B5C9Y4
Locus tag LOY12_RS03995 Protein ID WP_072357969.1
Coordinates 770585..770761 (+) Length 59 a.a.

Antitoxin (RNA)


Gene name SprF1
Locus tag -
Coordinates 770753..770892 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LOY12_RS03975 (765752) 765752..769534 + 3783 WP_016170804.1 phage tail spike protein -
LOY12_RS03980 (769527) 769527..769679 + 153 WP_001000058.1 hypothetical protein -
LOY12_RS03985 (769725) 769725..770012 + 288 WP_001262620.1 hypothetical protein -
LOY12_RS03990 (770068) 770068..770442 + 375 WP_000340977.1 hypothetical protein -
LOY12_RS03995 (770585) 770585..770761 + 177 WP_072357969.1 type I toxin-antitoxin system toxin PepG1 Toxin
- (770753) 770753..770892 - 140 NuclAT_0 - Antitoxin
- (770753) 770753..770892 - 140 NuclAT_0 - Antitoxin
- (770753) 770753..770892 - 140 NuclAT_0 - Antitoxin
- (770753) 770753..770892 - 140 NuclAT_0 - Antitoxin
LOY12_RS04000 (770814) 770814..770921 - 108 WP_031762631.1 hypothetical protein -
LOY12_RS04005 (770973) 770973..771227 + 255 WP_000611512.1 phage holin -
LOY12_RS04010 (771239) 771239..771994 + 756 WP_000861038.1 CHAP domain-containing protein -
LOY12_RS04015 (772185) 772185..772676 + 492 WP_000920041.1 staphylokinase -
LOY12_RS04020 (773327) 773327..773661 + 335 Protein_789 SH3 domain-containing protein -
LOY12_RS04025 (773754) 773754..774203 - 450 WP_000727645.1 chemotaxis-inhibiting protein CHIPS -
LOY12_RS04030 (774886) 774886..775236 + 351 WP_000702262.1 complement inhibitor SCIN-A -
LOY12_RS04035 (775289) 775289..775549 - 261 WP_001791826.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - groEL / hlb / sak / chp / scn 707711..775236 67525


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(30-58)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6863.47 Da        Isoelectric Point: 10.6777

>T269375 WP_072357969.1 NZ_CP116909:770585-770761 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Download         Length: 177 bp

Antitoxin


Download         Length: 140 bp

>AT269375 NZ_CP116909:c770892-770753 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6B5C9Y4

Antitoxin

Download structure file

References