Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 770585..770923 | Replicon | chromosome |
Accession | NZ_CP116909 | ||
Organism | Staphylococcus aureus strain AATYW |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
Locus tag | LOY12_RS03995 | Protein ID | WP_072357969.1 |
Coordinates | 770585..770761 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 770749..770923 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY12_RS03975 | 765752..769534 | + | 3783 | WP_016170804.1 | phage tail spike protein | - |
LOY12_RS03980 | 769527..769679 | + | 153 | WP_001000058.1 | hypothetical protein | - |
LOY12_RS03985 | 769725..770012 | + | 288 | WP_001262620.1 | hypothetical protein | - |
LOY12_RS03990 | 770068..770442 | + | 375 | WP_000340977.1 | hypothetical protein | - |
LOY12_RS03995 | 770585..770761 | + | 177 | WP_072357969.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 770749..770923 | - | 175 | - | - | Antitoxin |
LOY12_RS04005 | 770973..771227 | + | 255 | WP_000611512.1 | phage holin | - |
LOY12_RS04010 | 771239..771994 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
LOY12_RS04015 | 772185..772676 | + | 492 | WP_000920041.1 | staphylokinase | - |
LOY12_RS04020 | 773327..773661 | + | 335 | Protein_789 | SH3 domain-containing protein | - |
LOY12_RS04025 | 773754..774203 | - | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
LOY12_RS04030 | 774886..775236 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
LOY12_RS04035 | 775289..775549 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / chp / scn | 707711..775236 | 67525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T269373 WP_072357969.1 NZ_CP116909:770585-770761 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT269373 NZ_CP116909:c770923-770749 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|