Detailed information of TA system TA269372

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 747423..747837
• Replicon: chromosome
• Accession: NZ_CP116909
• Organism: Staphylococcus aureus strain AATYW

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: LOY12_RS03830
• Protein ID: WP_001065046.1
• Coordinates: 747423..747674 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: LOY12_RS03835
• Protein ID: WP_000028424.1
• Coordinates: 747664..747837 (+)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LOY12_RS03780 (742817)	742817..743737	+	921	WP_000138475.1	recombinase RecT	-
LOY12_RS03785 (743818)	743818..744435	+	618	WP_077517322.1	MBL fold metallo-hydrolase	-
LOY12_RS03790 (744436)	744436..744906	+	471	WP_000610649.1	single-stranded DNA-binding protein	-
LOY12_RS03795 (744936)	744936..745238	+	303	WP_089430320.1	hypothetical protein	-
LOY12_RS03800 (745254)	745254..745805	+	552	WP_089430321.1	DnaD domain protein	-
LOY12_RS03805 (745812)	745812..746030	+	219	WP_000338528.1	hypothetical protein	-
LOY12_RS03810 (746039)	746039..746444	+	406	Protein_747	RusA family crossover junction endodeoxyribonuclease	-
LOY12_RS03815 (746457)	746457..746825	+	369	WP_023604910.1	SA1788 family PVL leukocidin-associated protein	-
LOY12_RS03820 (746829)	746829..747071	+	243	WP_023604909.1	phi PVL orf 51-like protein	-
LOY12_RS03825 (747080)	747080..747430	+	351	WP_025176279.1	hypothetical protein	-
LOY12_RS03830 (747423)	747423..747674	+	252	WP_001065046.1	DUF1024 family protein	Toxin
LOY12_RS03835 (747664)	747664..747837	+	174	WP_000028424.1	hypothetical protein	Antitoxin
LOY12_RS03840 (747838)	747838..747990	+	153	WP_016170781.1	hypothetical protein	-
LOY12_RS03845 (748120)	748120..748281	+	162	WP_000889682.1	hypothetical protein	-
LOY12_RS03850 (748296)	748296..748829	+	534	WP_023604907.1	dUTPase	-
LOY12_RS03855 (748866)	748866..749072	+	207	WP_089430322.1	DUF1381 domain-containing protein	-
LOY12_RS03860 (749069)	749069..749272	+	204	WP_000141180.1	hypothetical protein	-
LOY12_RS03865 (749265)	749265..749501	+	237	WP_000608275.1	hypothetical protein	-
LOY12_RS03870 (749494)	749494..749880	+	387	WP_000592202.1	hypothetical protein	-
LOY12_RS03875 (749877)	749877..750026	+	150	WP_000595265.1	transcriptional activator RinB	-
LOY12_RS03880 (750026)	750026..750226	+	201	WP_000265043.1	DUF1514 family protein	-
LOY12_RS03885 (750254)	750254..750670	+	417	WP_000590122.1	hypothetical protein	-
LOY12_RS03890 (750902)	750902..751201	+	300	WP_000988336.1	HNH endonuclease	-
LOY12_RS03895 (751331)	751331..751675	+	345	WP_000402904.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	groEL / hlb / sak / chp / scn	707711..775236	67525

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9377.26 Da
• Isoelectric Point: 3.7128

>T269372 WP_001065046.1 NZ_CP116909:747423-747674 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT269372 WP_000028424.1 NZ_CP116909:747664-747837 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp