Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 584031..584309 | Replicon | chromosome |
Accession | NZ_CP116909 | ||
Organism | Staphylococcus aureus strain AATYW |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | LOY12_RS02880 | Protein ID | WP_001802298.1 |
Coordinates | 584031..584135 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 584131..584309 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY12_RS02865 | 580828..581610 | + | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
LOY12_RS02870 | 581678..582535 | + | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
LOY12_RS02875 | 583193..583351 | - | 159 | WP_001792784.1 | hypothetical protein | - |
LOY12_RS02880 | 584031..584135 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 584131..584309 | - | 179 | - | - | Antitoxin |
LOY12_RS02890 | 584568..585659 | - | 1092 | WP_000495669.1 | hypothetical protein | - |
LOY12_RS02895 | 585925..586902 | - | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
LOY12_RS02900 | 586904..587224 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
LOY12_RS02905 | 587376..588041 | + | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T269368 WP_001802298.1 NZ_CP116909:584031-584135 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 179 bp
>AT269368 NZ_CP116909:c584309-584131 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCA
AAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCA
AAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|