Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78769..79022 | Replicon | plasmid pKP2722-2 |
| Accession | NZ_CP116905 | ||
| Organism | Klebsiella pneumoniae strain KP2722 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PO783_RS29415 | Protein ID | WP_001312851.1 |
| Coordinates | 78769..78918 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78963..79022 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO783_RS29380 (74128) | 74128..74543 | - | 416 | Protein_89 | IS1-like element IS1B family transposase | - |
| PO783_RS29385 (74792) | 74792..75193 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| PO783_RS29390 (75126) | 75126..75383 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| PO783_RS29395 (75476) | 75476..76129 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| PO783_RS29400 (77068) | 77068..77925 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| PO783_RS29405 (77918) | 77918..77992 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| PO783_RS29410 (78237) | 78237..78485 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| PO783_RS29415 (78769) | 78769..78918 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (78963) | 78963..79022 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78963) | 78963..79022 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78963) | 78963..79022 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78963) | 78963..79022 | + | 60 | NuclAT_1 | - | Antitoxin |
| PO783_RS29420 (79223) | 79223..79555 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| PO783_RS29425 (79617) | 79617..80216 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| PO783_RS29430 (80602) | 80602..80802 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| PO783_RS29435 (80934) | 80934..81494 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| PO783_RS29440 (81549) | 81549..82295 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| PO783_RS29445 (82315) | 82315..82515 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| PO783_RS29450 (82540) | 82540..83244 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PO783_RS29455 (83296) | 83296..83640 | + | 345 | Protein_104 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | - | 1..134875 | 134875 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269358 WP_001312851.1 NZ_CP116905:c78918-78769 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT269358 NZ_CP116905:78963-79022 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|