Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42607..43033 | Replicon | plasmid pKP2722-2 |
| Accession | NZ_CP116905 | ||
| Organism | Klebsiella pneumoniae strain KP2722 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PO783_RS29165 | Protein ID | WP_001372321.1 |
| Coordinates | 42607..42732 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 42809..43033 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO783_RS29135 (37875) | 37875..38579 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PO783_RS29140 (38860) | 38860..39243 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PO783_RS29145 (39520) | 39520..40167 | + | 648 | WP_272525575.1 | transglycosylase SLT domain-containing protein | - |
| PO783_RS29150 (40464) | 40464..41285 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| PO783_RS29155 (41396) | 41396..41692 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| PO783_RS29160 (41992) | 41992..42288 | + | 297 | Protein_45 | hypothetical protein | - |
| PO783_RS29165 (42607) | 42607..42732 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PO783_RS29170 (42674) | 42674..42823 | - | 150 | Protein_47 | plasmid maintenance protein Mok | - |
| - (42809) | 42809..43033 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (42809) | 42809..43033 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (42809) | 42809..43033 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (42809) | 42809..43033 | - | 225 | NuclAT_0 | - | Antitoxin |
| PO783_RS29175 (43045) | 43045..43764 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| PO783_RS29180 (43761) | 43761..44195 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| PO783_RS29185 (44264) | 44264..46287 | - | 2024 | Protein_50 | ParB/RepB/Spo0J family partition protein | - |
| PO783_RS29190 (46348) | 46348..46581 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| PO783_RS29195 (46639) | 46639..47166 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| PO783_RS29200 (47468) | 47468..47923 | + | 456 | Protein_53 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | - | 1..134875 | 134875 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T269355 WP_001372321.1 NZ_CP116905:c42732-42607 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT269355 NZ_CP116905:c43033-42809 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
