Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 52109..52836 | Replicon | plasmid pKP2722-1 |
| Accession | NZ_CP116904 | ||
| Organism | Klebsiella pneumoniae strain KP2722 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | PO783_RS28245 | Protein ID | WP_011251285.1 |
| Coordinates | 52525..52836 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PO783_RS28240 | Protein ID | WP_011251286.1 |
| Coordinates | 52109..52528 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO783_RS28210 (PO783_28210) | 47277..47747 | - | 471 | WP_048333570.1 | hypothetical protein | - |
| PO783_RS28215 (PO783_28215) | 48060..48695 | - | 636 | WP_223171879.1 | hypothetical protein | - |
| PO783_RS28220 (PO783_28220) | 49114..49734 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| PO783_RS28225 (PO783_28225) | 49755..50543 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| PO783_RS28230 (PO783_28230) | 50557..50922 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| PO783_RS28235 (PO783_28235) | 50994..51962 | - | 969 | WP_074428168.1 | IS5 family transposase | - |
| PO783_RS28240 (PO783_28240) | 52109..52528 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PO783_RS28245 (PO783_28245) | 52525..52836 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PO783_RS28250 (PO783_28250) | 53041..53478 | - | 438 | Protein_64 | DDE-type integrase/transposase/recombinase | - |
| PO783_RS28255 (PO783_28255) | 53613..54310 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| PO783_RS28260 (PO783_28260) | 55696..56346 | - | 651 | WP_068893702.1 | DUF1173 family protein | - |
| PO783_RS28265 (PO783_28265) | 56379..56645 | - | 267 | WP_223175074.1 | DUF1173 family protein | - |
| PO783_RS28270 (PO783_28270) | 56823..57317 | + | 495 | WP_004212794.1 | thermonuclease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..181653 | 181653 | |
| - | inside | IScluster/Tn | - | - | 44269..75051 | 30782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T269353 WP_011251285.1 NZ_CP116904:c52836-52525 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT269353 WP_011251286.1 NZ_CP116904:c52528-52109 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|