Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50670..50909 | Replicon | plasmid pXH2172-NDM |
| Accession | NZ_CP116901 | ||
| Organism | Escherichia coli strain XH2172 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | PH219_RS23450 | Protein ID | WP_023144756.1 |
| Coordinates | 50775..50909 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 50670..50730 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH219_RS23425 (45787) | 45787..48180 | + | 2394 | Protein_52 | conjugative transfer relaxase/helicase TraI | - |
| PH219_RS23430 (48200) | 48200..48946 | + | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| PH219_RS23435 (49001) | 49001..49561 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| PH219_RS23440 (49692) | 49692..49904 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| PH219_RS23445 (50417) | 50417..50703 | + | 287 | Protein_56 | DUF2726 domain-containing protein | - |
| - (50670) | 50670..50730 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (50670) | 50670..50730 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (50670) | 50670..50730 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (50670) | 50670..50730 | - | 61 | NuclAT_0 | - | Antitoxin |
| PH219_RS23450 (50775) | 50775..50909 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| PH219_RS23455 (51206) | 51206..51460 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| PH219_RS23460 (51620) | 51620..52366 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PH219_RS23465 (52381) | 52381..53922 | - | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| PH219_RS23470 (54284) | 54284..54358 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| PH219_RS23475 (54351) | 54351..55208 | + | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / blaNDM-5 / aadA5 / aac(3)-IId / mph(A) / dfrA12 | - | 1..103554 | 103554 | |
| - | inside | Integron | aadA8b / qacE / aadA17 / dfrA12 | - | 1..103554 | 103553 | |
| - | inside | Integron | aadA17 / qacE / dfrA12 / aadA8b | - | 1..103554 | 103553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T269332 WP_023144756.1 NZ_CP116901:50775-50909 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT269332 NZ_CP116901:c50730-50670 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
