Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2512612..2513339 | Replicon | chromosome |
| Accession | NZ_CP116900 | ||
| Organism | Escherichia coli strain XH2172 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | PH219_RS12105 | Protein ID | WP_000547564.1 |
| Coordinates | 2512612..2512923 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PH219_RS12110 | Protein ID | WP_000126294.1 |
| Coordinates | 2512920..2513339 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH219_RS12075 (2507754) | 2507754..2509463 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| PH219_RS12080 (2509473) | 2509473..2510015 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| PH219_RS12085 (2510015) | 2510015..2510782 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| PH219_RS12090 (2510779) | 2510779..2511189 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| PH219_RS12095 (2511182) | 2511182..2511652 | + | 471 | WP_060621146.1 | hydrogenase maturation peptidase HycI | - |
| PH219_RS12100 (2511677) | 2511677..2512438 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| PH219_RS12105 (2512612) | 2512612..2512923 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PH219_RS12110 (2512920) | 2512920..2513339 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PH219_RS12115 (2513453) | 2513453..2514877 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| PH219_RS12120 (2514886) | 2514886..2516343 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| PH219_RS12125 (2516603) | 2516603..2517613 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| PH219_RS12130 (2517762) | 2517762..2518289 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T269319 WP_000547564.1 NZ_CP116900:2512612-2512923 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT269319 WP_000126294.1 NZ_CP116900:2512920-2513339 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|